Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FNDC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP15969020UL
Description
FNDC4 Polyclonal specifically detects FNDC4 in Human, Rabbit samples. It is validated for Western Blot.Specifications
FNDC4 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9H6D8 | |
FNDC4 | |
Synthetic peptides corresponding to FNDC4(fibronectin type III domain containing 4) The peptide sequence was selected from the middle region of FNDC4. Peptide sequence EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS. | |
Affinity Purified | |
RUO | |
64838 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
fibronectin type III domain containing 4, fibronectin type III domain-containing protein 4, Fibronectin type III repeat-containing protein 1, FRCP1FLJ22362 | |
Rabbit | |
25 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction