Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FNTA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155161

 View more versions of this product

Catalog No. NBP155161

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.



FNTA Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
CAAX farnesyltransferase subunit alpha, EC, EC, farnesyl-protein transferase alpha-subunit, farnesyltransferase, CAAX box, alpha, FPTA, FTase-alpha, GGTase-I-alpha, MGC99680, PGGT1A, protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha, protein prenyltransferase alpha subunit repeat containing 2, PTAR2, Ras proteins prenyltransferase subunit alpha, type I protein geranyl-geranyltransferase alpha subunit, Type I protein geranyl-geranyltransferase subunit alpha
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
This product is specific to Subunit or Isoform: alpha.
Immunohistochemistry, Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry
Affinity Purified
Synthetic peptides corresponding to FNTA(farnesyltransferase, CAAX box, alpha) The peptide sequence was selected from the N terminal of FNTA. Peptide sequence MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASP.
36 kDa
100 ul
Signal Transduction
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit