Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FosB/G0S3 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31091425UL

 View more versions of this product

Catalog No. NB126728

Add to cart



FosB/G0S3 Polyclonal specifically detects FosB/G0S3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.


PBS buffer, 2% sucrose
activator protein 1, AP-1, DKFZp686C0818, FBJ murine osteosarcoma viral oncogene homolog B, G0S3G0/G1 switch regulatory protein 3, GOS3, GOSB, MGC42291, oncogene FOS-B, protein fosB
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat FosB/G0S3 (XP_002725585). Peptide sequence AFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGS
25 μg
Cancer, Tumor Suppressors
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Affinity purified
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Human, Rat
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit