Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FosB/G0S3 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen FosB/G0S3
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126728
View Documents
Novus Biologicals
NBP31091425UL
25 μg
Each for $106.19
Add to cart
 
NB126727
View Documents
Novus Biologicals
NBP310914100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

FosB/G0S3 Polyclonal antibody specifically detects FosB/G0S3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

FosB/G0S3
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Purified
RUO
Human, Rat
activator protein 1, AP-1, DKFZp686C0818, FBJ murine osteosarcoma viral oncogene homolog B, G0S3G0/G1 switch regulatory protein 3, GOS3, GOSB, MGC42291, oncogene FOS-B, protein fosB
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat FosB/G0S3 (XP_002725585). Peptide sequence AFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
Cancer, Tumor Suppressors
PBS buffer, 2% sucrose
2354
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit