Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FOXI3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179274
Description
FOXI3 Polyclonal specifically detects FOXI3 in Human samples. It is validated for Western Blot.Specifications
FOXI3 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
XP_001133410 | |
FOXI3 | |
Synthetic peptide directed towards the C terminal of human LOC730270. Peptide sequence TTQPRGQREGAGDLRKEDSVRKELDLYIHIRRGGPIRETKKICIPEQKAT. | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
forkhead box I3, forkhead box protein I3, FOXI3 forkhead box I3 | |
Rabbit | |
Protein A purified | |
RUO | |
344167 | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title