Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOXI3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179274

 View more versions of this product

Catalog No. NBP179274


Add to cart

Description

Description

FOXI3 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

FOXI3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
FOXI3
Synthetic peptide directed towards the C terminal of human LOC730270. Peptide sequence TTQPRGQREGAGDLRKEDSVRKELDLYIHIRRGGPIRETKKICIPEQKAT.
Protein A purified
RUO
Primary
344167
Human
Western Blot
Western Blot 1:1000
XP_001133410
forkhead box I3, forkhead box protein I3, FOXI3 forkhead box I3
Rabbit
IgG
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit