Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FOXI3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | FOXI3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179274
|
Novus Biologicals
NBP179274 |
100 μL |
Each of 1 for $436.00
|
|
Description
FOXI3 Polyclonal specifically detects FOXI3 in Human samples. It is validated for Western Blot.Specifications
FOXI3 | |
Polyclonal | |
Purified | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
forkhead box I3, forkhead box protein I3, FOXI3 forkhead box I3 | |
FOXI3 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
XP_001133410 | |
344167 | |
Synthetic peptide directed towards the C terminal of human LOC730270. Peptide sequence TTQPRGQREGAGDLRKEDSVRKELDLYIHIRRGGPIRETKKICIPEQKAT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title