Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FoxJ1/HFH4 Mouse anti-Human, Clone: , Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP259033

Catalog No. NBP259033


Add to cart

Description

Description

FoxJ1/HFH4 Monoclonal antibody specifically detects FoxJ1/HFH4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

FoxJ1/HFH4
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
FKHL13forkhead transcription factor HFH-4, forkhead box J1, forkhead-like 13, Forkhead-related protein FKHL13, Hepatocyte nuclear factor 3 forkhead homolog 4, HFH4fork head homologue 4, HFH-4forkhead box protein J1, MGC35202
Mouse
IgG1
100 ul
Cancer, Transcription Factors and Regulators
Primary
2302
Human
Immunohistochemistry (Paraffin)
Immunohistochemistry-Paraffin 1:200 - 1:500
Purified
FOXJ1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Protein A purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only