Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOXL2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen FOXL2
Immunogen Synthetic peptides corresponding to Foxl2 (forkhead box L2) The peptide sequence was selected from the C terminal of Foxl2. Peptide sequence SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1690320 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16903120UL
20ul This item has been discontinued and is no longer available. Please call customer service for assistance: 1-800-766-7000.
N/A
NBP169031 View Documents Novus BiologicalsSupplier Diversity Partner
NBP169031
100 ul This item has been discontinued and is no longer available. Please call customer service for assistance: 1-800-766-7000.
N/A
Description

Description

FOXL2 Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.
Specifications

Specifications

FOXL2
Rabbit
Polyclonal
Unconjugated
668
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to Foxl2 (forkhead box L2) The peptide sequence was selected from the C terminal of Foxl2. Peptide sequence SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD.
Primary
IgG
BPES, BPES1PINTO, forkhead box L2, forkhead box protein L2, forkhead transcription factor FOXL2, PFRK, POF3
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit