Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FOXO4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258083

Catalog No. NBP258083


Add to cart

Description

Description

FOXO4 Polyclonal antibody specifically detects FOXO4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

FOXO4
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
AFX, AFX1myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 7, Fork head domain transcription factor AFX1, forkhead box O4, forkhead box protein O4, MLLT7MGC120490, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 7
Rabbit
IgG
100 ul
Cell Cycle and Replication
Primary
4303
Human
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
FOXO4
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only