Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FOXR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309247100UL
Description
FOXR1 Polyclonal specifically detects FOXR1 in Human samples. It is validated for Western Blot.Specifications
FOXR1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
DLNB13, Forkhead box protein N5, forkhead box R1, forkhead box R1 variant 1, FOXN5forkhead box protein R1, MGC149486 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXR1 (NP_859072). Peptide sequence KKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKREDLTSTLPSSQ | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
283150 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction