Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FOXRED1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FOXRED1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157478
|
Novus Biologicals
NBP157478 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FOXRED1 Polyclonal specifically detects FOXRED1 in Human samples. It is validated for Western Blot.Specifications
| FOXRED1 | |
| Polyclonal | |
| Rabbit | |
| Q96CU9 | |
| 55572 | |
| Synthetic peptides corresponding to FOXRED1(FAD-dependent oxidoreductase domain containing 1) The peptide sequence was selected from the N terminal of FOXRED1. Peptide sequence SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FAD-dependent oxidoreductase domain containing 1, FAD-dependent oxidoreductase domain-containing protein 1, H17 | |
| FOXRED1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title