Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Frequenin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71


Antigen Frequenin
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μg
Each for $320.71
Add to cart
View Documents
Novus Biologicals
25 μg
Each for $106.19
Add to cart


Frequenin Polyclonal antibody specifically detects Frequenin in Human samples. It is validated for Western Blot, Immunohistochemistry


Western Blot, Immunohistochemistry
PBS buffer, 2% sucrose
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry
DKFZp761L1223, FREQFLUP, frequenin (Drosophila) homolog, Frequenin homolog, frequenin homolog (Drosophila), Frequenin-like protein, Frequenin-like ubiquitous protein, NCS-1, neuronal calcium sensor 1
The immunogen is a synthetic peptide directed towards the middle region of human Frequenin (NP_055101). Peptide sequence EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit