Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FSD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | FSD1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
FSD1 Polyclonal specifically detects FSD1 in Human samples. It is validated for Western Blot.Specifications
| FSD1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS buffer, 2% sucrose | |
| 79187 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| fibronectin type 3 and SPRY domain containing 1, fibronectin type III and SPRY domain containing 1, fibronectin type III and SPRY domain-containing protein 1, GLFNDfibronectin type 3 and SPRY (spla, ryanodine) domain containing (withcoiled-coil motif) 1, MGC3213, Microtubule-associated protein GLFND, midline 1-related protein 1, MIR1MID1-related protein 1 | |
| The immunogen is a synthetic peptide directed towards the middle region of human FSD1 (NP_077309.1). Peptide sequence SPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEVRYEPDS | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title