Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FSD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen FSD1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125101
View Documents
Novus Biologicals
NBP310100100UL
100 μg N/A
NB125102
View Documents
Novus Biologicals
NBP31010025UL
25 μg N/A
Description

Description

FSD1 Polyclonal antibody specifically detects FSD1 in Human samples. It is validated for Western Blot
Specifications

Specifications

FSD1
Western Blot
Purified
RUO
Human
fibronectin type 3 and SPRY domain containing 1, fibronectin type III and SPRY domain containing 1, fibronectin type III and SPRY domain-containing protein 1, GLFNDfibronectin type 3 and SPRY (spla, ryanodine) domain containing (withcoiled-coil motif) 1, MGC3213, Microtubule-associated protein GLFND, midline 1-related protein 1, MIR1MID1-related protein 1
The immunogen is a synthetic peptide directed towards the middle region of human FSD1 (NP_077309.1). Peptide sequence SPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEVRYEPDS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Stem Cell Markers
PBS buffer, 2% sucrose
79187
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit