Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FTS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15310620UL
Description
FTS Polyclonal specifically detects FTS in Human samples. It is validated for Western Blot.Specifications
FTS | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9H8T0 | |
AKTIP | |
Synthetic peptides corresponding to AKTIP(AKT interacting protein) The peptide sequence was selected from the middle region of AKTIP. Peptide sequence NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
AKT interacting protein, AKT-interacting protein, FLJ13258, Ft1, FTSfused toes homolog (mouse), fused toes (mouse) homolog, fused toes homolog, Fused toes protein homolog | |
Rabbit | |
33 kDa | |
20 μL | |
Apoptosis | |
64400 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction