Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fucosyltransferase 8/FUT8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Fucosyltransferase 8/FUT8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17986920
|
Novus Biologicals
NBP17986920UL |
20 μL |
Each for $152.22
|
|
NBP179869
|
Novus Biologicals
NBP179869 |
100 μL |
Each for $436.00
|
|
Description
Fucosyltransferase 8/FUT8 Polyclonal specifically detects Fucosyltransferase 8/FUT8 in Human samples. It is validated for Western Blot.Specifications
| Fucosyltransferase 8/FUT8 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| alpha-(1,6)-fucosyltransferase, alpha1-6FucT, EC 2.4.1.68, Fucosyltransferase 8, fucosyltransferase 8 (alpha (1,6) fucosyltransferase), GDP-fucose--glycoprotein fucosyltransferase, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, Glycoprotein 6-alpha-L-fucosyltransferase, MGC26465 | |
| FUT8 | |
| IgG | |
| Affinity Purified | |
| 47 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_004471 | |
| 2530 | |
| The immunogen for this antibody is FUT8. Peptide sequence LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title