Invitrogen™ FUS Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579286

Catalog No. PIPA579286

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human K562 whole cell, mouse NIH3T3 whole cell.

This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Specifications

• Antigen: FUS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: FUS
• Gene Alias: 16) in malignant liposarcoma); 16) malignant liposarcoma; 75 kDa DNA-pairing protein; ALS6; D430004D17Rik; D930039C12Rik; ETM4; FUS; FUS RNA binding protein; Fus1; fused in sarcoma; fused in sarcoma RNA binding protein; fusion (involved in t(12; fusion gene in myxoid liposarcoma; fusion, derived from t(12; fusion, derived from t(12;16) malignant liposarcoma; fus-like protein; heterogeneous nuclear ribonucleoprotein P2; hnRNP P2; HNRNPP2; oncogene FUS; Oncogene TLS; pigpen protein; POMP75; Protein pigpen; RNA-binding protein FUS; TLS; translocated in liposarcoma; translocated in liposarcoma protein
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 233908, 2521, 317385
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P35637, P56959
• Gene Symbols: FUS
• Immunogen: A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG