Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FVT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31058825UL
Description
FVT1 Polyclonal specifically detects FVT1 in Human samples. It is validated for Western Blot.Specifications
FVT1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
3-ketodihydrosphingosine reductase, DHSR, EC 1.1.1.102,3-dehydrosphinganine reductase, FLJ36555, FLJ92680, follicular lymphoma variant translocation 1, Follicular variant translocation protein 1, FVT-1, FVT1KDS reductase, SDR35C1, short chain dehydrogenase/reductase family 35C, member 1 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of human FVT1 (NP_002026.1). Peptide sequence KKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCA | |
25 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
2531 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction