Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FXYD5/Dysadherin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159138
Description
FXYD5/Dysadherin Polyclonal specifically detects FXYD5/Dysadherin in Human samples. It is validated for Western Blot.Specifications
FXYD5/Dysadherin | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DYSAD, dysadherin, FXYD domain containing ion transport regulator 5, FXYD domain-containing ion transport regulator 5, IWU1, KCT1, keratinocytes associated transmembrane protein 1, OIT2, PRO6241, RIC | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q96DB9 | |
FXYD5 | |
Synthetic peptides corresponding to FXYD5(FXYD domain containing ion transport regulator 5) The peptide sequence was selected from the middle region of FXYD5. Peptide sequence SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG. | |
100 μL | |
Signal Transduction | |
53827 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction