Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FZR1/CDH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | FZR1/CDH1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15697620
|
Novus Biologicals
NBP15697620UL |
20 μL |
Each for $152.22
|
|
NBP156976
|
Novus Biologicals
NBP156976 |
100 μL |
Each for $436.00
|
|
Description
FZR1/CDH1 Polyclonal specifically detects FZR1/CDH1 in Human samples. It is validated for Western Blot.Specifications
| FZR1/CDH1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| Q9UM11 | |
| 51343 | |
| Synthetic peptides corresponding to FZR1/CDH1 (fizzy/cell division cycle 20 related 1 (Drosophila)) The peptide sequence was selected from the N terminal of FZR1/CDH1. Peptide sequence SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CDC20C, CDH1, Cdh1/Hct1 homolog, CDH1CDC20-like 1b, fizzy/cell division cycle 20 related 1 (Drosophila), Fzr, FZR2, FZRCDC20-like protein 1, hCDH1, HCDHFYR, KIAA1242fizzy-related protein homolog | |
| FZR1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title