Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FZR1/CDH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen FZR1/CDH1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15697620
View Documents
Novus Biologicals
NBP15697620UL
20 μL
Each for $152.22
Add to cart
 
NBP156976
View Documents
Novus Biologicals
NBP156976
100 μL
Each for $436.00
Add to cart
 
Description

Description

FZR1/CDH1 Polyclonal specifically detects FZR1/CDH1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FZR1/CDH1
Polyclonal
Rabbit
Cell Cycle and Replication
Q9UM11
51343
Synthetic peptides corresponding to FZR1/CDH1 (fizzy/cell division cycle 20 related 1 (Drosophila)) The peptide sequence was selected from the N terminal of FZR1/CDH1. Peptide sequence SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
CDC20C, CDH1, Cdh1/Hct1 homolog, CDH1CDC20-like 1b, fizzy/cell division cycle 20 related 1 (Drosophila), Fzr, FZR2, FZRCDC20-like protein 1, hCDH1, HCDHFYR, KIAA1242fizzy-related protein homolog
FZR1
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit