Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G protein alpha 12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | G protein alpha 12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB15743020
|
Novus Biologicals
NBP15532120UL |
20 μL |
Each for $152.22
|
|
NBP155321
|
Novus Biologicals
NBP155321 |
100 μL |
Each for $436.00
|
|
Description
G protein alpha 12 Polyclonal specifically detects G protein alpha 12 in Human samples. It is validated for Western Blot.Specifications
| G protein alpha 12 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Q03113 | |
| 2768 | |
| Synthetic peptides corresponding to GNA12(guanine nucleotide binding protein (G protein) alpha 12) The peptide sequence was selected from the middle region of GNA12. Peptide sequence TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| 44 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| G alpha-12, gep, G-protein subunit alpha-12, guanine nucleotide binding protein (G protein) alpha 12, guanine nucleotide-binding protein subunit alpha-12, MGC104623, MGC99644, NNX3, RMP, WUGSC:H_GS165O14.2 | |
| GNA12 | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: alpha-12. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title