Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

G protein alpha 12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen G protein alpha 12
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB15743020
View Documents
Novus Biologicals
NBP15532120UL
20 μL
Each for $152.22
Add to cart
 
NBP155321
View Documents
Novus Biologicals
NBP155321
100 μL
Each for $436.00
Add to cart
 
Description

Description

G protein alpha 12 Polyclonal specifically detects G protein alpha 12 in Human samples. It is validated for Western Blot.
Specifications

Specifications

G protein alpha 12
Polyclonal
Rabbit
Signal Transduction
Q03113
2768
Synthetic peptides corresponding to GNA12(guanine nucleotide binding protein (G protein) alpha 12) The peptide sequence was selected from the middle region of GNA12. Peptide sequence TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
44 kDa
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
G alpha-12, gep, G-protein subunit alpha-12, guanine nucleotide binding protein (G protein) alpha 12, guanine nucleotide-binding protein subunit alpha-12, MGC104623, MGC99644, NNX3, RMP, WUGSC:H_GS165O14.2
GNA12
IgG
Affinity Purified
This product is specific to Subunit or Isoform: alpha-12.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit