Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

G protein beta 4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17968120UL

 View more versions of this product

Catalog No. NBP1796820


Add to cart

Description

Description

G protein beta 4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

G protein beta 4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GNB4
Synthetic peptide directed towards the middle region of human GNB4. Peptide sequence DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY.
37 kDa
20ul
Signal Transduction
Primary
59345
Western Blot
Western Blot 1:1000
NP_067642
G protein beta-4 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 4, guanine nucleotide binding protein beta subunit 4, guanine nucleotide-binding protein subunit beta-4, Transducin beta chain 4
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit