Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

G9a/EHMT2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen G9a/EHMT2
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Applications Western Blot, ChIP assay
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126784
View Documents
Novus Biologicals
NBP31094225UL
25 μg
Each for $106.19
Add to cart
 
NB126783
View Documents
Novus Biologicals
NBP310942100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

G9a/EHMT2 Polyclonal antibody specifically detects G9a/EHMT2 in Human samples. It is validated for Western Blot, ChIP assay
Specifications

Specifications

G9a/EHMT2
Western Blot, ChIP assay
Purified
RUO
Human
ankyrin repeat-containing protein, BAT8, C6orf30, chromosome 6 open reading frame 30, DKFZp686H08213, EC 2.1.1.-, EC 2.1.1.43, euchromatic histone-lysine N-methyltransferase 2HLA-B-associated transcript 8, FLJ35547, G9A histone methyltransferase, G9AEm:AF134726.3, H3-K9-HMTase 3, Histone H3-K9 methyltransferase 3, histone-lysine N-methyltransferase, H3 lysine-9 specific 3, HLA-B associated transcript 8, KMT1CNG36/G9a, Lysine N-methyltransferase 1C, NG36, Protein G9a
The immunogen is a synthetic peptide directed towards the N terminal region of human G9a/EHMT2 (NP_006700). Peptide sequence VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Unconjugated
Rabbit
Breast Cancer
PBS buffer, 2% sucrose
10919
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit