Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GABA-A R pi Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP182390
Description
GABA-A R pi Polyclonal specifically detects GABA-A R pi in Mouse samples. It is validated for Western Blot.Specifications
GABA-A R pi | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
GABA(A) receptor subunit pi, gamma-aminobutyric acid (GABA) A receptor, pi, gamma-aminobutyric acid receptor subunit pi, MGC126386, MGC126387 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Chicken: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_666129 | |
GABRP | |
Synthetic peptide towards GABA A receptor pi. Peptide sequence GFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLR. | |
100 μL | |
Signal Transduction | |
2568 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction