GABA-A R rho 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179971

Catalog No. NBP179971

Description

GABA-A R rho 1 Polyclonal specifically detects GABA-A R rho 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GABA-A R rho 1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_002033
• Gene Symbols: GABRR1
• Immunogen: Synthetic peptide directed towards the N terminal of human GABRR1. Peptide sequence MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 86%; Rat: 86%.
• Target Species: Human, Rat, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: GABA(C) receptor, gamma-aminobutyric acid (GABA) A receptor, rho-1, gamma-aminobutyric acid (GABA) receptor, rho 1, gamma-aminobutyric acid receptor subunit rho-1, rho 1)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2569
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.