Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GABA-A R rho 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17997120UL
Description
GABA-A R rho 1 Polyclonal specifically detects GABA-A R rho 1 in Human samples. It is validated for Western Blot.Specifications
GABA-A R rho 1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
NP_002033 | |
GABRR1 | |
Synthetic peptide directed towards the N terminal of human GABRR1. Peptide sequence MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
GABA(C) receptor, gamma-aminobutyric acid (GABA) A receptor, rho-1, gamma-aminobutyric acid (GABA) receptor, rho 1, gamma-aminobutyric acid receptor subunit rho-1, rho 1) | |
Rabbit | |
Affinity Purified | |
RUO | |
2569 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title