Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GADD45 alpha Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17979120UL

 View more versions of this product

Catalog No. NBP1797920


Add to cart

Description

Description

GADD45 alpha Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

GADD45 alpha
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GADD45A
Synthetic peptide directed towards the C terminal of human GADD45AThe immunogen for this antibody is GADD45A. Peptide sequence LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA.
18 kDa
20ul
Apoptosis, Cancer
Primary
1647
Western Blot
Western Blot 0.2-1 ug/ml
NP_001915
DDIT-1, DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha, DNA damage-inducible transcript 1 protein, DNA damage-inducible transcript-1, GADD45DNA-damage-inducible transcript 1, growth arrest and DNA-damage-inducible 45 alpha, growth arrest and DNA-damage-inducible, alpha
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit