Abnova™ GAL Recombinant Protein

Human GAL full-length ORF recombinant protein with GST-tag at N-terminal

Catalog Number	Mfr. No.	Quantity
89-012-779	Abnova™ H00051083P0110	10 ug
89-012-780	Abnova™ H00051083P0125	25 ug

Description

Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions.

• Theoretical MW (kDa): 39.27
• Preparation method: In vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH30241
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 39.27
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: GAL
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 51083
• Name: GAL (Human) Recombinant Protein (P01)
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
• Gene Alias: GALN/GLNN/GMAP/MGC40167
• Gene Symbol: GAL
• Species: Wheat Germ (in vitro)
• Protein Tag: GST