GAL3ST4 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179326

Catalog No. NBP179326

Description

GAL3ST4 Polyclonal specifically detects GAL3ST4 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: GAL3ST4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001028588
• Gene Symbols: GAL3ST4
• Immunogen: The immunogen for this antibody is Gal3st4. Peptide sequence RPLQFGSAKVLGYVLQSGLNQKDKEECERLATPELQYKDKLDAKQFPPTV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.8.2.-, GAL3ST-4, galactose-3-O-sulfotransferase 44,Beta-galactose-3-O-sulfotransferase 4, Gal-beta-1,3-GalNAc 3'-sulfotransferase, galbeta1-3GalNAc 3'-sulfotransferase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79690
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.