Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GAL3ST4 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GAL3ST4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179326
|
Novus Biologicals
NBP179326 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GAL3ST4 Polyclonal specifically detects GAL3ST4 in Mouse samples. It is validated for Western Blot.Specifications
| GAL3ST4 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.8.2.-, GAL3ST-4, galactose-3-O-sulfotransferase 44,Beta-galactose-3-O-sulfotransferase 4, Gal-beta-1,3-GalNAc 3'-sulfotransferase, galbeta1-3GalNAc 3'-sulfotransferase | |
| GAL3ST4 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001028588 | |
| 79690 | |
| The immunogen for this antibody is Gal3st4. Peptide sequence RPLQFGSAKVLGYVLQSGLNQKDKEECERLATPELQYKDKLDAKQFPPTV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title