Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Galectin-related protein B Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310206100UL
Description
Galectin-related protein B Polyclonal specifically detects Galectin-related protein B in Mouse samples. It is validated for Western Blot.Specifications
Galectin-related protein B | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Rabbit | |
Affinity purified | |
RUO | |
272350 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
The immunogen is a synthetic peptide directed towards the middle region of mouse GRPB. Peptide sequence RSPVQAGVYFRGHIKGGMRPGKKVLVMGIVDHNPKSFAISLTCGDSEDPP | |
100 μg | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction