Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GALNT9 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179313

 View more versions of this product

Catalog No. NBP179313


Add to Cart

Description

Description

GALNT9 Polyclonal specifically detects GALNT9 in Human samples. It is validated for Western Blot.
Specifications

Specifications

GALNT9
Polyclonal
Western Blot 1.0 ug/ml
XP_001129598
GALNT9
Synthetic peptide directed towards the N terminal of human LOC729185. Peptide sequence VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG.
100 μL
Primary
Expected identity based on immunogen sequence: Human: 100% Bovine: 78%.
Human, Porcine, Bovine, Equine
IgG
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.4.1.41, GalNAc transferase 9, GALNAC-T9, GALNT9 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 9 (GalNAc-T9), Polypeptide GalNAc transferase 9, polypeptide N-acetylgalactosaminyltransferase 9, pp-GaNTase 9, Protein-UDP acetylgalactosaminyltransferase 9, UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase 9, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 9 (GalNAc-T9)
Rabbit
Affinity Purified
RUO
50614
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at -20C. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit