GALNT9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179313

Catalog No. NBP179313

Description

GALNT9 Polyclonal specifically detects GALNT9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GALNT9
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: XP_001129598
• Gene Symbols: GALNT9
• Immunogen: Synthetic peptide directed towards the N terminal of human LOC729185. Peptide sequence VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100% Bovine: 78%.
• Target Species: Human, Porcine, Bovine, Equine
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.41, GalNAc transferase 9, GALNAC-T9, GALNT9 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 9 (GalNAc-T9), Polypeptide GalNAc transferase 9, polypeptide N-acetylgalactosaminyltransferase 9, pp-GaNTase 9, Protein-UDP acetylgalactosaminyltransferase 9, UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase 9, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 9 (GalNAc-T9)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 50614
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.