Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GALNT9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GALNT9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179313
|
Novus Biologicals
NBP179313 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GALNT9 Polyclonal specifically detects GALNT9 in Human samples. It is validated for Western Blot.Specifications
| GALNT9 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.4.1.41, GalNAc transferase 9, GALNAC-T9, GALNT9 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 9 (GalNAc-T9), Polypeptide GalNAc transferase 9, polypeptide N-acetylgalactosaminyltransferase 9, pp-GaNTase 9, Protein-UDP acetylgalactosaminyltransferase 9, UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase 9, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 9 (GalNAc-T9) | |
| GALNT9 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| XP_001129598 | |
| 50614 | |
| Synthetic peptide directed towards the N terminal of human LOC729185. Peptide sequence VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title