Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gamma-glutamyltransferase 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Gamma-glutamyltransferase 2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179312
|
Novus Biologicals
NBP179312 |
100 μL |
Each of 1 for $436.00
|
|
Description
Gamma-glutamyltransferase 2 Polyclonal specifically detects Gamma-glutamyltransferase 2 in Human samples. It is validated for Western Blot.Specifications
Gamma-glutamyltransferase 2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
728441 | |
Synthetic peptide directed towards the N terminal of human GGT2. Peptide sequence LEIGRDTLRDGGSAVDAAIAALLCVGLMNAHSMGIGVGLFLTIYNSTTGK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
gamma-glutamyltransferase 2, gamma-glutamyltranspeptidase 2 | |
GGT2 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title