GANC Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156805

Catalog No. NBP156805

Description

GANC Polyclonal specifically detects GANC in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GANC
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TET4
• Gene Symbols: GANC
• Immunogen: Synthetic peptides corresponding to GANC(glucosidase, alpha; neutral C) The peptide sequence was selected from the middle region of GANC. Peptide sequence VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Rabbit: 100%; Rat: 100%; Canine: 85%; Equine: 85%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.2.1, EC 3.2.1.20, glucosidase, alpha; neutral C, MGC138256, neutral alpha-glucosidase C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2595
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.