Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GANC Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GANC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156805
|
Novus Biologicals
NBP156805 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GANC Polyclonal specifically detects GANC in Human samples. It is validated for Western Blot.Specifications
| GANC | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.2.1, EC 3.2.1.20, glucosidase, alpha; neutral C, MGC138256, neutral alpha-glucosidase C | |
| GANC | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TET4 | |
| 2595 | |
| Synthetic peptides corresponding to GANC(glucosidase, alpha; neutral C) The peptide sequence was selected from the middle region of GANC. Peptide sequence VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title