Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GARS Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15460220UL

 View more versions of this product

Catalog No. NBP15460220


Add to cart

Description

Description

GARS Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

GARS
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GARS
Synthetic peptides corresponding to GARS(glycyl-tRNA synthetase) The peptide sequence was selected from the middle region of GARS. Peptide sequence IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN.
83 kDa
20ul
Core ESC Like Genes, Stem Cell Markers
Primary
2617
Western Blot
Western Blot 0.2-1 ug/ml
P41250
AP-4-A synthetase, Charcot-Marie-Tooth neuropathy 2D, Charcot-Marie-Tooth neuropathy, neuronal type, D, Diadenosine tetraphosphate synthetase, DSMAV, glycine tRNA ligase, Glycine--tRNA ligase, glycyl-tRNA synthetase, GlyRSEC 6.1.1.14, HMN5, SMAD1CMT2D
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit