Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109356

CPC Scientific H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific GIPS002B

Encompass

GIP fragment that presents potent insulinotropic activity in the isolated perfused rat pancreas, but greatly inhibits somatostatinotropic activity in the isolated perfused rat stomach. The site responsible for insulinotropic activity lies between 19 and 30 of GIP. ONE-LETTER SEQUENCE: YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2MOLECULAR FORMULA: C162H245N41O47S1MOLECULAR WEIGHT:3551.04STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [134846-93-8], SYNONYMS: Gastric Inhibitory Polypeptide (1-30) amide (porcine), Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine), GIP (1-30) amide (porcine)RESEARCH AREA: DiabetesREFERENCES: W.J.Rossowski et al., Reg. Pep., 39, 9 (1992)

Catalog No. 50-210-9356


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.