Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GATM Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15476420UL
Description
GATM Polyclonal specifically detects GATM in Human samples. It is validated for Western Blot.Specifications
GATM | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
P50440 | |
GATM | |
Synthetic peptides corresponding to GATM(glycine amidinotransferase (L-arginine:glycine amidinotransferase)) The peptide sequence was selected from the middle region of GATM. Peptide sequence PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFK | |
Affinity Purified | |
RUO | |
2628 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
AGATtransamidinase, AT, EC 2.1.4, EC 2.1.4.1, glycine amidinotransferase (L-arginine:glycine amidinotransferase), glycine amidinotransferase, mitochondrial, L-arginine:glycine amidinotransferase, Transamidinase | |
Rabbit | |
44 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title