Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GBX1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191420

 View more versions of this product

Catalog No. NBP191420


Add to cart

Description

Description

GBX1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

GBX1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GBX1
The specific Immunogen is proprietary information. Peptide sequence AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP.
40 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Fruit fly: 100%; Medaka fish: 100%; Green puffer: 100%; Body louse: 100%; Red flour beetle: 100%; African malaria mosquito: 92%; Western clawed frog: 92%; Florida lancelet: 92%; Yellowfever mosquito: 92%; Common carp: 92%; Mosquito: 92%; Xenopus: 92%; Southern house mosquito: 92%; Common lancelet: 91%; Budgerigar: 85%; Bovine: 85%; Canine: 85%; Dumeril's clam worm: 85%; Bobwhite quail: 85%; Bornean orangutan: 85%; Chimpanzee: 85%; Pig-tailed macaque: 85%; Common woolly monkey: 85%; Black-handed spider monkey: 85%; Pygmy chimpanzee: 85%; Western Gorilla: 78%; Gibbula varia: 78%.
Human
Western Blot
Western Blot 0.2-1 ug/ml
NP_001092304
gastrulation brain homeo box 1, gastrulation brain homeobox 1, homeobox protein GBX-1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
2636
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit