Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GBX1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191420
Description
GBX1 Polyclonal specifically detects GBX1 in Human samples. It is validated for Western Blot.Specifications
GBX1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
gastrulation brain homeo box 1, gastrulation brain homeobox 1, homeobox protein GBX-1 | |
Rabbit | |
40 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Fruit fly: 100%; Medaka fish: 100%; Green puffer: 100%; Body louse: 100%; Red flour beetle: 100%; African malaria mosquito: 92%; Western clawed frog: 92%; Florida lancelet: 92%; Yellowfever mosquito: 92%; Common carp: 92%; Mosquito: 92%; Xenopus: 92%; Southern house mosquito: 92%; Common lancelet: 91%; Budgerigar: 85%; Bovine: 85%; Canine: 85%; Dumeril's clam worm: 85%; Bobwhite quail: 85%; Bornean orangutan: 85%; Chimpanzee: 85%; Pig-tailed macaque: 85%; Common woolly monkey: 85%; Black-handed spider monkey: 85%; Pygmy chimpanzee: 85%; Western Gorilla: 78%; Gibbula varia: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_001092304 | |
GBX1 | |
The immunogen is a synthetic peptide directed towards the middle region of human GBX1. Peptide Sequence AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP. The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
2636 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction