Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GCAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154868
Description
GCAP1 Polyclonal specifically detects GCAP1 in Human samples. It is validated for Western Blot.Specifications
GCAP1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
P43080 | |
GUCA1A | |
Synthetic peptides corresponding to GUCA1A(guanylate cyclase activator 1A (retina)) The peptide sequence was selected from the N terminal of GUCA1A. Peptide sequence LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK. | |
Affinity Purified | |
RUO | |
Primary | |
Guinea pig: 86%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C6orf131, chromosome 6 open reading frame 131, CORD14, GCAP 1, GCAP1photoreceptor 1, GCAPGUCA, Guanylate cyclase activator 1A, guanylate cyclase activator 1A (retina), guanylin 1, retina, guanylyl cyclase-activating protein 1, GUCA1 | |
Rabbit | |
23 kDa | |
100 μL | |
Vision | |
2978 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title