Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GCAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15486820UL

 View more versions of this product

Catalog No. NBP15486820


Add to cart

Description

Description

GCAP1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

GCAP1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GUCA1A
Synthetic peptides corresponding to GUCA1A(guanylate cyclase activator 1A (retina)) The peptide sequence was selected from the N terminal of GUCA1A. Peptide sequence LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK.
23 kDa
20ul
Vision
Primary
2978
Western Blot
Western Blot 1:100-1:2000
P43080
C6orf131, chromosome 6 open reading frame 131, CORD14, GCAP 1, GCAP1photoreceptor 1, GCAPGUCA, Guanylate cyclase activator 1A, guanylate cyclase activator 1A (retina), guanylin 1, retina, guanylyl cyclase-activating protein 1, GUCA1
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit