Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GCDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15464120UL
Description
GCDH Polyclonal specifically detects GCDH in Human samples. It is validated for Western Blot.Specifications
GCDH | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q92947 | |
GCDH | |
Synthetic peptides corresponding to GCDH(glutaryl-Coenzyme A dehydrogenase) The peptide sequence was selected from the N terminal of GCDH. Peptide sequence SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
ACAD5, EC 1.3.99, EC 1.3.99.7, GCD, glutaryl-CoA dehydrogenase, glutaryl-CoA dehydrogenase, mitochondrial, glutaryl-Coenzyme A dehydrogenase | |
Rabbit | |
43 kDa | |
20 μL | |
Stem Cell Markers | |
2639 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction