Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GCDH Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | GCDH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1546420
|
Novus Biologicals
NBP15464120UL |
20 μL |
Each for $152.22
|
|
NBP154641
|
Novus Biologicals
NBP154641 |
100 μL |
Each for $436.00
|
|
Description
GCDH Polyclonal specifically detects GCDH in Human samples. It is validated for Western Blot.Specifications
| GCDH | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| ACAD5, EC 1.3.99, EC 1.3.99.7, GCD, glutaryl-CoA dehydrogenase, glutaryl-CoA dehydrogenase, mitochondrial, glutaryl-Coenzyme A dehydrogenase | |
| GCDH | |
| IgG | |
| Affinity Purified | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q92947 | |
| 2639 | |
| Synthetic peptides corresponding to GCDH(glutaryl-Coenzyme A dehydrogenase) The peptide sequence was selected from the N terminal of GCDH. Peptide sequence SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title