Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GCET2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | GCET2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154596
|
Novus Biologicals
NBP154596 |
100 μL |
Each of 1 for $436.00
|
N/A | |||||
Description
GCET2 Polyclonal specifically detects GCET2 in Human samples. It is validated for Western Blot.Specifications
| GCET2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8N6F7 | |
| 257144 | |
| Synthetic peptides corresponding to GCET2(germinal center expressed transcript 2) The peptide sequence was selected from the middle region of GCET2. Peptide sequence YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| GAL, GCAT2, germinal center B-cell-expressed transcript 2 protein, germinal center expressed transcript 2, Germinal center-associated lymphoma protein, HGAL, MGC40441 | |
| GCSAM | |
| IgG | |
| Affinity Purified | |
| 21 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title