Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GDC Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $299.00


Antigen GDC
Immunogen Synthetic peptides corresponding to SLC25A16(solute carrier family 25, member 16) The peptide sequence was selected from the N terminal of SLC25A16. Peptide sequence KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15958720 View Documents Novus BiologicalsSupplier Diversity Partner
20ul Each for $149.00
Add to cart
NBP159587 View Documents Novus BiologicalsSupplier Diversity Partner
100ul Each for $299.00
Add to cart


GDC Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


Western Blot
Synthetic peptides corresponding to SLC25A16(solute carrier family 25, member 16) The peptide sequence was selected from the N terminal of SLC25A16. Peptide sequence KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM.
D10S105EGDC, GDASolute carrier family 25 member 16, Graves disease autoantigen, graves disease carrier protein, HGT.1, hML7, member 16, MGC39851, Mitochondrial solute carrier protein homolog, ML7, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen)
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit