GDF-11/BMP-11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257399

Catalog No. NBP257399

Description

GDF-11/BMP-11 Polyclonal specifically detects GDF-11/BMP-11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GDF-11/BMP-11
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: BMP-11BMP11Bone morphogenetic protein 11, GDF-11, growth differentiation factor 11, growth/differentiation factor 11
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GDF11
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT
• Quantity: 100 μL
• Research Discipline: Cytokine Research
• Gene ID (Entrez): 10220
• Target Species: Human
• Isotype: IgG

For Research Use Only