Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GDF-9 Mouse anti-Human, Biotin, Clone: 53/1, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP261934B

Catalog No. NBP261934B


Add to cart

Description

Description

GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry.
Specifications

Specifications

GDF-9
53/1
Western Blot, ELISA, Immunohistochemistry
Purified
GDF9
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Protein A purified
Cytokine Research
Primary
2661
ELISA, Immunohistochemistry, Western Blot
Biotin
PBS with 0.05% Sodium Azide
GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Mouse
IgG1
0.1mL
Store at 4°C in the dark.
Monoclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit