Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GDF-9 Mouse anti-Human, Biotin, Clone: 53/1, Novus Biologicals™
Mouse Monoclonal Antibody
Manufacturer: Novus Biologicals NBP261934B
Description
GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry.Specifications
GDF-9 | |
53/1 | |
Western Blot, ELISA, Immunohistochemistry | |
PBS with 0.05% Sodium Azide | |
2661 | |
Mouse | |
IgG1 | |
Primary | |
0.1mL | |
Store at 4°C in the dark. |
ELISA,Immunohistochemistry,Western Blot | |
Biotin | |
Purified | |
GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
GDF9 | |
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9 | |
Monoclonal | |
Protein A purified | |
Cytokine Research | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title