Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
---Azide-and-BSA-Free-ELISA-NBP2-61934-img0001.jpg-650.jpg)
---Azide-and-BSA-Free-ELISA-NBP2-61934-img0002.jpg-650.jpg)
---Azide-and-BSA-Free-ELISA-NBP2-61934-img0003.jpg-650.jpg)
---Azide-and-BSA-Free-ELISA-NBP2-61934-img0004.jpg-650.jpg)
GDF-9 Antibody (53/1) - Azide and BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP261934
Description
GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry.Specifications
| GDF-9 | |
| Monoclonal | |
| 1mg/mL | |
| Western Blot, ELISA, Immunohistochemistry | |
| GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
| Mouse | |
| Protein A purified | |
| Cytokine Research | |
| 2661 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
| ELISA, Immunohistochemistry, Western Blot | |
| 53/1 | |
| Unconjugated | |
| PBS with 0.02% Sodium Azide | |
| GDF9 | |
| Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9 | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction