Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GDF-9 Mouse anti-Human, Clone: GDF9/4261, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP30727320UG

 View more versions of this product

Catalog No. NB122020

Add to cart



GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry-Paraffin.


10 mM PBS with 0.05% BSA
GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9.
Protein A or G purified
Store at 4°C.
Western Blot, ELISA, Immunohistochemistry (Paraffin)
0.2 mg/ml
Western Blot 1-2 ug/ml, ELISA, Immunohistochemistry-Paraffin 1-2 ug/ml
20 μg
Cytokine Research
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit